PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G288200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 436aa    MW: 45882.2 Da    PI: 9.7197
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G288200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1377.1e-12302360563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr +r   NR++A +s +RK +++ eLe++v +L+ e ++L ++++  + e++ lk+++
  Sevir.2G288200.1.p 302 KRVKRILANRISAAKSKERKVKYMGELERRVHVLQMETSTLFSKANFSQRECEVLKTQN 360
                         899*****************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-15298362IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.852300363IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.0E-9302359No hitNo description
PfamPF001707.2E-11302360IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.21E-11302358No hitNo description
CDDcd147031.01E-17303354No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MDLSSQYQRR FAPSLFLPPM APPRGLASGS GFSAFSNYQG PPALSPAAAG GSHLARSLPK  60
APFFSADSLA ALPYAADPAA GAAVQRSPPS LGSEQQGPSV SGLPPRGAGH RRSRSDFVVG  120
FSLQNQLPLP VLPAAEGYSK SADAAALEEL FRSYRDPKAL GVLGSSGDGP NDRNSHLGNQ  180
VNSQRAWSPA DSSDNEAESW ATGSGGGGGG STSQRRHCRS LSVDSIMGNL NFGALGQVSP  240
TLPPPSPVSG PGGSGSHTGS GPSGSAAAVA TSELANGEFT ESEMKKIMAN DRLAEIALAD  300
PKRVKRILAN RISAAKSKER KVKYMGELER RVHVLQMETS TLFSKANFSQ RECEVLKTQN  360
NEMKIRLQAL EQQALLKDAL NQALSAEVHR LKLAAGETSD AHAPNDSHHH MSRQILEQQL  420
LQLQKQPSEA QKAQQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699390.10.0PREDICTED: transcription factor RF2a-like
TrEMBLK4A0W60.0K4A0W6_SETIT; Uncharacterized protein
STRINGSi032507m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148701820
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-51bZIP family protein